DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dif and LOC110438511

DIOPT Version :9

Sequence 1:NP_001162998.1 Gene:Dif / 35045 FlyBaseID:FBgn0011274 Length:987 Species:Drosophila melanogaster
Sequence 2:XP_021326734.1 Gene:LOC110438511 / 110438511 -ID:- Length:499 Species:Danio rerio


Alignment Length:276 Identity:58/276 - (21%)
Similarity:95/276 - (34%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 SAVSDSISVSRSRNGSLSSNRTTPSPIIIMRTPDQSPTKRQPTPSASPKKRQGFFSRFFSRRRSK 769
            :|..||::.:.|....:::.|.:.....::......|.|....|            .||.....:
Zfish   280 NAYVDSVTYNGSTALHIAAGRGSTKLSALLMAAGADPHKENCEP------------LFFRDEEEE 332

  Fly   770 TDDEESLTPGGSPNKQLPGGSKATTPTGSREPSVAHFSLGDPNRSSTRSMQPLGKSEGRNGKPVG 834
            .:|:|...||.||.      |.|.:      |.|.:...|:..:.||..:.|.|..:.       
Zfish   333 DEDDEGFIPGSSPL------SLAVS------PEVYNILNGEEYQPSTIVVPPQGDMQS------- 378

  Fly   835 RSSSSVSGKRPAHLD---------ADVIHIPLKGGDSENSLLRPESYSNASTLSYGRPLDRKTLS 890
             .||||.....:.||         |||:.:.:.     ||..|      .|:...|:.||...:|
Zfish   379 -LSSSVKQDLCSALDGPAGGWETLADVLGLGIL-----NSAFR------LSSCPAGKLLDSYEVS 431

  Fly   891 ---TLQLADIPISDGNMELIAIADRQSIKNLCEGAYGVVLDPSVDLSEAEHFALYTSKSPEPPFG 952
               .|:|.:.....||...:.:..    .::||....|...|.:  :.|.......:..||    
Zfish   432 GGTVLELLEGLKRVGNCSAVTLLQ----NSVCEEPKSVHNTPPI--TGAGVCKALQALGPE---- 486

  Fly   953 GECGEGGAATGGVDTT 968
                |.|....||:|:
Zfish   487 ----ESGVCDSGVETS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DifNP_001162998.1 RHD-n_Dorsal_Dif 78..252 CDD:143647
RHD_dimer 256..358 CDD:292797
LOC110438511XP_021326734.1 Ank_2 88..183 CDD:315466
ANK repeat 113..150 CDD:293786
ANK 147..276 CDD:238125
ANK repeat 152..183 CDD:293786
ANK repeat 225..252 CDD:293786
ANK repeat 255..287 CDD:293786 3/6 (50%)
Ank_5 258..>316 CDD:330893 5/35 (14%)
ANK repeat 289..320 CDD:293786 4/30 (13%)
DD 383..455 CDD:326335 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.