DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and polr2j

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001039095.1 Gene:polr2j / 733914 XenbaseID:XB-GENE-972012 Length:117 Species:Xenopus tropicalis


Alignment Length:115 Identity:89/115 - (77%)
Similarity:102/115 - (88%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH 65
            |||||.||||||:||||||....||||.||.:|||||||||:||:|::||||||.||||||||||
 Frog     1 MNAPPAFESFLLFEGEKKITITKDTKVPNACLFTINKEDHTIGNIIKSQLLKDPQVLFAGYKVPH 65

  Fly    66 PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEG 115
            |||||.:||:|||.||||||||.||||||::||||.||||:.|||:|:||
 Frog    66 PLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 70/90 (78%)
polr2jNP_001039095.1 RNAP_II_RPB11 14..105 CDD:132902 70/90 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4542
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2771
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.