DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and polr2j

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001019571.1 Gene:polr2j / 554099 ZFINID:ZDB-GENE-050522-120 Length:117 Species:Danio rerio


Alignment Length:115 Identity:91/115 - (79%)
Similarity:102/115 - (88%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH 65
            |||||.||||||:||||||....||||.||.:||:|||||||||:||:||||||.||||||||||
Zfish     1 MNAPPAFESFLLFEGEKKITITKDTKVPNACLFTLNKEDHTLGNIIRSQLLKDPQVLFAGYKVPH 65

  Fly    66 PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEG 115
            |||||.|||:|||.||||||||.||||||::||||.||||:.|||:|:||
Zfish    66 PLEHKVVIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 72/90 (80%)
polr2jNP_001019571.1 RNAP_II_RPB11 14..105 CDD:132902 72/90 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595938
Domainoid 1 1.000 129 1.000 Domainoid score I5228
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4542
Inparanoid 1 1.050 189 1.000 Inparanoid score I3884
OMA 1 1.010 - - QHG54303
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0002958
OrthoInspector 1 1.000 - - oto38785
orthoMCL 1 0.900 - - OOG6_101401
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2771
SonicParanoid 1 1.000 - - X1954
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.