DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and POLR2J

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001380848.1 Gene:POLR2J / 5439 HGNCID:9197 Length:159 Species:Homo sapiens


Alignment Length:117 Identity:86/117 - (73%)
Similarity:98/117 - (83%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH 65
            |||||.||||||:||||||....||||.||.:||||||||||||:|::||||||.||||||||||
Human     1 MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPH 65

  Fly    66 PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKKEGGD 117
            |||||.:||:|||.||||||||.||||||::||||.||||:  ::....|.|
Human    66 PLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR--VRAGPGGAD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 71/90 (79%)
POLR2JNP_001380848.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5243
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4542
Inparanoid 1 1.050 189 1.000 Inparanoid score I3903
Isobase 1 0.950 - 0 Normalized mean entropy S336
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 1 1.000 - - FOG0002958
OrthoInspector 1 1.000 - - otm40450
orthoMCL 1 0.900 - - OOG6_101401
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2771
SonicParanoid 1 1.000 - - X1954
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.