DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and polr1d

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001003888.1 Gene:polr1d / 445412 ZFINID:ZDB-GENE-040930-4 Length:112 Species:Danio rerio


Alignment Length:106 Identity:38/106 - (35%)
Similarity:56/106 - (52%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GEKKIIKELDTKVTN--AAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQT 77
            |:|..::.:.|...:  ...|.:|:|||||||.:|..::|..:|.|.||.:.||.|.|...||||
Zfish     5 GQKHALEMVRTDGADEGCVTFVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQT 69

  Fly    78 TADYSPQEAF---MNAITDLLAE-LSLFEERFKDAIKEKKE 114
            .......|..   :|.:||:... |..||.|.|: .||::|
Zfish    70 RDGVPASEPLRNGLNNLTDVCKHVLQTFEARMKE-FKEQEE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 33/95 (35%)
polr1dNP_001003888.1 RNAP_I_III_AC19 13..97 CDD:132907 29/83 (35%)
RNA_pol_L 24..>55 CDD:279526 15/30 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.