powered by:
Protein Alignment Rpb11 and l(2)37Cg
DIOPT Version :9
Sequence 1: | NP_609836.1 |
Gene: | Rpb11 / 35043 |
FlyBaseID: | FBgn0032634 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001260563.1 |
Gene: | l(2)37Cg / 35196 |
FlyBaseID: | FBgn0086447 |
Length: | 132 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 21/48 - (43%) |
Similarity: | 27/48 - (56%) |
Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 FTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQTTAD 80
|....|.|||||.::..:.:.|.|.|.||.:|||.|.|...|||:..|
Fly 47 FVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45445044 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1761 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1398114at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR13946 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.850 |
|
Return to query results.
Submit another query.