DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and rpb11

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_593333.1 Gene:rpb11 / 2543112 PomBaseID:SPAC3A12.07 Length:123 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:52/105 - (49%)
Similarity:67/105 - (63%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH 65
            ||.|..:|...|. |..|:..|||:|..|||:.|:.||||||.||:.||||.|..||||||||||
pombe     1 MNQPERYELIELM-GLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAGYKVPH 64

  Fly    66 PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERF 105
            ||.|.|::|:||..|.||::..::|...|:..|...:..|
pombe    65 PLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNF 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 46/90 (51%)
rpb11NP_593333.1 RNAP_II_RPB11 14..104 CDD:132902 46/89 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 86 1.000 Domainoid score I2189
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1613
OMA 1 1.010 - - QHG54303
OrthoFinder 1 1.000 - - FOG0002958
OrthoInspector 1 1.000 - - oto100562
orthoMCL 1 0.900 - - OOG6_101401
Panther 1 1.100 - - LDO PTHR13946
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2771
SonicParanoid 1 1.000 - - X1954
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.