DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and POLR2J2

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_116581.3 Gene:POLR2J2 / 246721 HGNCID:23208 Length:115 Species:Homo sapiens


Alignment Length:109 Identity:82/109 - (75%)
Similarity:94/109 - (86%) Gaps:1/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNAPPTFESFLLYEGEKKIIKELDTKVTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPH 65
            |||||.||||||:||||..|.: ||||..|.:||||||||||||:|::||||||.||||||||||
Human     1 MNAPPAFESFLLFEGEKITINK-DTKVPKACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPH 64

  Fly    66 PLEHKFVIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAI 109
            |||||.:||:|||.||||||||.||||||::||||.||||:..:
Human    65 PLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 69/90 (77%)
POLR2J2NP_116581.3 RNAP_II_RPB11 14..104 CDD:132902 69/90 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159717
Domainoid 1 1.000 129 1.000 Domainoid score I5243
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002958
OrthoInspector 1 1.000 - - otm40450
orthoMCL 1 0.900 - - OOG6_101401
Panther 1 1.100 - - O PTHR13946
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1954
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.850

Return to query results.
Submit another query.