DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and Polr1d

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_033113.1 Gene:Polr1d / 20018 MGIID:108403 Length:133 Species:Mus musculus


Alignment Length:107 Identity:38/107 - (35%)
Similarity:54/107 - (50%) Gaps:11/107 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EGEKKIIKELDTKVTNAA-------IFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKF 71
            |||:|...|:    ..||       .|.:::|||||||.:|..::|:|.|.|.||...||.|.|.
Mouse    20 EGERKTALEM----VQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKI 80

  Fly    72 VIRIQTTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKK 113
            .:||||.......|.|...:.:||........:|:.:||:.|
Mouse    81 NLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKDYK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 34/97 (35%)
Polr1dNP_033113.1 RNAP_I_III_AC19 30..114 CDD:132907 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.