DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb11 and rpac-19

DIOPT Version :9

Sequence 1:NP_609836.1 Gene:Rpb11 / 35043 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_499132.1 Gene:rpac-19 / 176362 WormBaseID:WBGene00010230 Length:144 Species:Caenorhabditis elegans


Alignment Length:102 Identity:32/102 - (31%)
Similarity:53/102 - (51%) Gaps:6/102 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KKIIKELDTK-----VTNAAIFTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQ 76
            ||.::.||.|     .:|..:. :.:||||:||.|::.|.:...|.|.||.||||||.|.:.|:|
 Worm    43 KKKMEILDPKSFEQDPSNLTLI-MYEEDHTIGNSIKHILSRMDEVEFCGYNVPHPLEDKILFRVQ 106

  Fly    77 TTADYSPQEAFMNAITDLLAELSLFEERFKDAIKEKK 113
            |....:..|....|...:....|....:|:::.::.:
 Worm   107 TKDGINALEVLAKAFESVEQIFSTIRGKFEESYEQSQ 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 31/92 (34%)
rpac-19NP_499132.1 RNAP_I_III_AC19 52..135 CDD:132907 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.