DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and BIK1

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_009901.1 Gene:BIK1 / 850328 SGDID:S000000534 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:515 Identity:105/515 - (20%)
Similarity:191/515 - (37%) Gaps:154/515 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 GILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECK-PKYGVFVPIAKV-SLSPSSKKTR 316
            |.|:|:|......|.:.||:|....|||||:....:||:.: |:.|:|:.:.|| ||...:..::
Yeast    20 GQLKYVGPVDTKAGMFAGVDLLANIGKNDGSFMGKKYFQTEYPQSGLFIQLQKVASLIEKASISQ 84

  Fly   317 LSRTGSRESLTSIGTMNSIATTATSRMRMNAQQRKSSTPVKPILATPKSQFSMQDLLREKQQHVE 381
            .||..:.|.| ||....||.........|:  ..||.||::....|.:...:.|.:.:|...|.:
Yeast    85 TSRRTTMEPL-SIPKNRSIVRLTNQFSPMD--DPKSPTPMRSFRITSRHSGNQQSMDQEASDHHQ 146

  Fly   382 KLMVERDLDREDAQNQALQLQKNINEVIIFTDTMYAPLPYADRSRPYRPSKKSRVKVPQQQHIWV 446
            :.....| :|||        :..::.::           .:||...:..:..           |.
Yeast   147 QQEFGYD-NRED--------RMEVDSIL-----------SSDRKANHNTTSD-----------WK 180

  Fly   447 PTTLSSSITTSTSTRPTIAAATAAAAAAAACNRQPLQQQQQPHLHQKQQQAKPKKVWFCDKKKLF 511
            |.  :..:....|:..||....|         :..:::.|:..||.|:                 
Yeast   181 PD--NGHMNDLNSSEVTIELREA---------QLTIEKLQRKQLHYKR----------------- 217

  Fly   512 PLKARIVELESALDNERKKTEELQCSIDEAQFCGDELNAQSQVYKEKIHDLESKITKLVSATPSL 576
                       .||::|...||:|.:.|..:                                  
Yeast   218 -----------LLDDQRMVLEEVQPTFDRYE---------------------------------- 237

  Fly   577 QSILPPDLPSDDGALQEEIAKLQEKMTIQQKEVESRIAEQLEEEQRLRENVKYL----NEQIATL 637
                               |.:||:    :||:: .:.:|||.|:|.:...|..    |||:..:
Yeast   238 -------------------ATIQER----EKEID-HLKQQLELERRQQAKQKQFFDAENEQLLAV 278

  Fly   638 QSELVSKDEALEKFSLSECGIENLRRELELLKEENEKQAQEAQAEFTRKLAEKSVEVLRLSSELQ 702
            .|:|..:.:..|:.:||.........::||||::.| |.:..:.:|       .:...:.:.|.:
Yeast   279 VSQLHEEIKENEERNLSHNQPTGANEDVELLKKQLE-QLRNIEDQF-------ELHKTKWAKERE 335

  Fly   703 NLKATSDSLESERVNKTDECEILQ------TEVRMRDEQIRELNQ---QLDEVTTQLNVQ 753
            .||..:|||..|..|.:.|..:.:      .||....:::.|.|:   ||::...|..|:
Yeast   336 QLKMHNDSLSKEYQNLSKELFLTKPQDSSSEEVASLTKKLEEANEKIKQLEQAQAQTAVE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039
CAP_GLY 125..189 CDD:396049
CAP_GLY 239..306 CDD:396049 18/52 (35%)
SMC_prok_B <546..912 CDD:274008 43/221 (19%)
Smc 734..1591 CDD:224117 6/23 (26%)
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
BIK1NP_009901.1 CAP_GLY 8..73 CDD:396049 18/52 (35%)
SMC_prok_B 193..>395 CDD:274008 56/304 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5390
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1398
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.