DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and EMB2804

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_187633.2 Gene:EMB2804 / 820184 AraportID:AT3G10220 Length:243 Species:Arabidopsis thaliana


Alignment Length:71 Identity:29/71 - (40%)
Similarity:40/71 - (56%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VGDRVIVSSGFGSRPGILRYLGETQ-FAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVP 302
            ||||..|..  |.:.|:::|:|..: ..||.|.|::.|||.||:||.|...|:|||....|..|.
plant   161 VGDRCQVEP--GEKRGMVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRFFECPRLQGGMVR 223

  Fly   303 IAKVSL 308
            ..||.:
plant   224 PDKVKV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039
CAP_GLY 125..189 CDD:396049
CAP_GLY 239..306 CDD:396049 27/67 (40%)
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
EMB2804NP_187633.2 Ubiquitin_2 14..96 CDD:405277
CAP_GLY 161..228 CDD:214997 28/68 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3743
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.