DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and EMB2804

DIOPT Version :10

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_187633.2 Gene:EMB2804 / 820184 AraportID:AT3G10220 Length:243 Species:Arabidopsis thaliana


Alignment Length:71 Identity:29/71 - (40%)
Similarity:40/71 - (56%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 VGDRVIVSSGFGSRPGILRYLGETQ-FAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVP 302
            ||||..|..  |.:.|:::|:|..: ..||.|.|::.|||.||:||.|...|:|||....|..|.
plant   161 VGDRCQVEP--GEKRGMVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRFFECPRLQGGMVR 223

  Fly   303 IAKVSL 308
            ..||.:
plant   224 PDKVKV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039
CAP_GLY 125..189 CDD:460154
CAP_GLY 239..306 CDD:460154 27/67 (40%)
SMC_prok_B <546..912 CDD:274008
SMC_prok_B 743..1596 CDD:274008
COG4913 <1534..>1703 CDD:443941
CLIP1_ZNF 1726..1743 CDD:465212
CLIP1_ZNF 1773..1789 CDD:465212
EMB2804NP_187633.2 Ubiquitin_2 14..96 CDD:405277
CAP_GLY 161..228 CDD:214997 28/68 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.