powered by:
Protein Alignment CLIP-190 and EMB2804
DIOPT Version :9
Sequence 1: | NP_001368962.1 |
Gene: | CLIP-190 / 35042 |
FlyBaseID: | FBgn0020503 |
Length: | 1795 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_187633.2 |
Gene: | EMB2804 / 820184 |
AraportID: | AT3G10220 |
Length: | 243 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 40/71 - (56%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 239 VGDRVIVSSGFGSRPGILRYLGETQ-FAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVP 302
||||..|.. |.:.|:::|:|..: ..||.|.|::.|||.||:||.|...|:|||....|..|.
plant 161 VGDRCQVEP--GEKRGMVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRFFECPRLQGGMVR 223
Fly 303 IAKVSL 308
..||.:
plant 224 PDKVKV 229
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
62 |
1.000 |
Domainoid score |
I3743 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.