DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and clip3

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:XP_005157797.1 Gene:clip3 / 562450 ZFINID:ZDB-GENE-131127-193 Length:539 Species:Danio rerio


Alignment Length:291 Identity:102/291 - (35%)
Similarity:148/291 - (50%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DNSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYF 174
            ||....|..::....:|.||.|..|:.|.:.|.|.|.||:|:|.|:.||||.|||||.|.|.|||
Zfish   269 DNIPGNLMLSSLGLKLGDRVVLDETKTGTLRFCGTTEFASGQWVGLELDEPEGKNDGSVGGIRYF 333

  Fly   175 QCEPKRGIFSRLTRLT----TYPLAGAQTPTSP----------LAKSSPDRSRTVSPTASIRSSM 225
            .|..|:|||:.::::|    ..|.:...||.:|          :.|...::.|..:|.....|.:
Zfish   334 ICSAKQGIFAPVSKITKAVEQTPSSVTSTPKTPRMDLSRVTGKIKKEKKEKDREKTPRKKSLSGV 398

  Fly   226 LRSPGIGGKNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRY 290
            ...|. |.|  :.|||:|:|:   |.:.||:|:.|:|.||||.|.||||::|:||:||:|..:||
Zfish   399 SLDPD-GVK--VEVGDQVLVA---GQKQGIVRFFGKTDFAPGYWFGVELEQPTGKHDGSVFGVRY 457

  Fly   291 FECKPKYGVFVPIAKVSLSPSSKKTRLSRTGSRESLTSIGTMNSIATTATSRMRMNAQQRKSSTP 355
            |.|.||||||.|       ||    |:.|.|..:.....||:    .....::.|:..:|..:..
Zfish   458 FHCLPKYGVFAP-------PS----RVQRIGGPKDPQGDGTL----VKKVHQVTMSQPKRNFNAV 507

  Fly   356 VKPILATPKSQFSMQDL--------LREKQQ 378
            ..|...|.:|..|.:.|        ||.:.|
Zfish   508 RSPKDITSESSISSRLLFCCWFPWMLRAEMQ 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039 3/7 (43%)
CAP_GLY 125..189 CDD:396049 33/63 (52%)
CAP_GLY 239..306 CDD:396049 37/66 (56%)
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
clip3XP_005157797.1 ANK 100..222 CDD:238125
ANK repeat 108..145 CDD:293786
Ank_2 110..216 CDD:289560
ANK repeat 147..178 CDD:293786
ANK repeat 186..216 CDD:293786
CAP_GLY 285..348 CDD:279625 33/62 (53%)
CAP_GLY 410..473 CDD:279625 38/76 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D463666at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.