DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and tbcb

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_997940.1 Gene:tbcb / 337350 ZFINID:ZDB-GENE-030131-9296 Length:246 Species:Danio rerio


Alignment Length:150 Identity:43/150 - (28%)
Similarity:62/150 - (41%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CCNHTTPKSGPPPREATSMSRESDDNLSSINSAY------------------------TDNSSAV 115
            |..|.|.:||....|.|.:|:.....:|  :.||                        .....||
Zfish    85 CRIHVTDRSGTQSGEFTDLSKVEKFEIS--DEAYEKRADSIRNFKKNMKLGRFNEEERAKQEEAV 147

  Fly   116 LTANTEQFIIGQRVWLG----------GTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSG 170
            .....|:.:..:.:.:|          .|:.|.:.::|...|..|.|.||..|||.||:||.|:|
Zfish   148 AKKEEEEKVAAEAIAVGNRCKVQVPGQATKIGTVMYVGTADFKPGYWVGVKYDEPLGKHDGSVNG 212

  Fly   171 KRYFQCEPKRGIFSRLTRLT 190
            ||||:||||.|.|.:...:|
Zfish   213 KRYFECEPKYGAFVKPLTVT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039 13/66 (20%)
CAP_GLY 125..189 CDD:396049 28/73 (38%)
CAP_GLY 239..306 CDD:396049
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
tbcbNP_997940.1 Alp11_N 12..95 CDD:176384 4/9 (44%)
CAP_GLY 164..228 CDD:279625 28/63 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.