DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and Clip3

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001100971.1 Gene:Clip3 / 308493 RGDID:1306245 Length:547 Species:Rattus norvegicus


Alignment Length:321 Identity:102/321 - (31%)
Similarity:160/321 - (49%) Gaps:54/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IPQPSKM---KAPSSFGSTGSVSKIGRPCCNHTTPKSGPPPREATSMSRESDDNLSSINSAYTDN 111
            :|.|..|   ||.::.     |:|..|.......|.|...|:               :.....||
  Rat   238 VPDPMDMSLDKAEAAL-----VAKELRTLLEEAVPLSCTLPK---------------VTLPNYDN 282

  Fly   112 SSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSGKRYFQC 176
            ....|..:.....:|.||.|.|.:.|.:.|.|.|.||:|:|.||.||||.|||||.|.|.|||.|
  Rat   283 VPGNLMLSALGLRLGDRVLLDGQKTGTLRFCGTTEFASGQWVGVELDEPEGKNDGSVGGVRYFIC 347

  Fly   177 EPKRGIFSRLTRLT----TYPLAGAQTPTSPLAKSS--------PDRSRTVSPTASIRSSMLRSP 229
            .||:|:|:.:::::    ..|.:...||.:|....|        ..:.:..||::....|:.:..
  Rat   348 PPKQGLFASVSKVSKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKSPSSPSLGSLQQRE 412

  Fly   230 GIGGKNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECK 294
            |...:    |||:|:|:   |.:.||:|:.|:|.||||.|.|:|||:|:||:||:|..:|||.|.
  Rat   413 GAKAE----VGDQVLVA---GQKQGIVRFYGKTDFAPGYWYGIELDQPTGKHDGSVFGVRYFTCA 470

  Fly   295 PKYGVFVPIAKV-----SLSP------SSKKTRLSRTGSRESLTSIGTMNSIAT-TATSRM 343
            |::|||.|.:::     |..|      :.|..:::.|..:.:.|::.|...||: .:.||:
  Rat   471 PRHGVFAPASRIQRIGGSTDPPGDSVGAKKVHQVTMTQPKRTFTTVRTPKDIASENSISRL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039 14/70 (20%)
CAP_GLY 125..189 CDD:396049 34/63 (54%)
CAP_GLY 239..306 CDD:396049 35/66 (53%)
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
Clip3NP_001100971.1 ANK repeat 120..157 CDD:293786
Ank_2 122..228 CDD:403870
ANK repeat 159..190 CDD:293786
ANK repeat 198..228 CDD:293786
CAP_GLY 296..360 CDD:396049 34/63 (54%)
CAP_GLY 418..482 CDD:396049 35/66 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5244
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D463666at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.