DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and LOC110440079

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:XP_021335167.1 Gene:LOC110440079 / 110440079 -ID:- Length:212 Species:Danio rerio


Alignment Length:258 Identity:73/258 - (28%)
Similarity:114/258 - (44%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1485 NGELKEALCQKENGLKELQGKLDESNTVLESQKKSHNEIQDKLEQAQQKERTLQEETSKLAEQLS 1549
            |..:..:|||                  ||..|:.:.:|||:          |..||.:|.:|:.
Zfish     4 NYTVYSSLCQ------------------LELLKQQNTQIQDQ----------LSSETERLRQQIE 40

  Fly  1550 QLKQANEELQKSLQQKQLLLEKGNEFDTQLAEYQKVIDEMDDAASVKSALLEQLQNRVAELETAL 1614
            :||....:.|.|||::|..|.:  :.|..:.|....:  |.|    |...||.|:|.:|    ||
Zfish    41 ELKLNAVQRQASLQEEQGTLTE--QLDITVRENSNAL--MSD----KDKELEMLRNEIA----AL 93

  Fly  1615 RQANDAQKTAYLETKELRRQLESLELEKS---REVLSLKAQMNGASSRSGKGDEVESLDIET--- 1673
            |..|       ..||.|:..:.|||.:|:   ..|.||:.::....:.||:....|...:|.   
Zfish    94 RGEN-------AMTKTLKSAVTSLEEDKAELLERVNSLEQKLELRHTHSGQQSSTEDTTVEQLRE 151

  Fly  1674 ----SLAKINFLNSIIADMQQKNDALKAKVQTLETLPMDFTKPHAFDALT----KRKPAPRLF 1728
                :..:||||||:|.|:|:||:.||.|::.:..  .:|......|.|.    |:|..||:|
Zfish   152 EKEFAEGQINFLNSVIVDLQRKNEELKVKLKKMAL--TEFNGNEDNDGLVEVKKKKKAPPRVF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039
CAP_GLY 125..189 CDD:396049
CAP_GLY 239..306 CDD:396049
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117 26/105 (25%)
SHE3 1502..1702 CDD:293683 61/209 (29%)
CLIP1_ZNF 1773..1789 CDD:406934
LOC110440079XP_021335167.1 SMC_N <9..>212 CDD:330553 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.