DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CLIP-190 and clip3

DIOPT Version :9

Sequence 1:NP_001368962.1 Gene:CLIP-190 / 35042 FlyBaseID:FBgn0020503 Length:1795 Species:Drosophila melanogaster
Sequence 2:NP_001120145.1 Gene:clip3 / 100145183 XenbaseID:XB-GENE-5806327 Length:534 Species:Xenopus tropicalis


Alignment Length:289 Identity:100/289 - (34%)
Similarity:152/289 - (52%) Gaps:45/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NLSSINSAYTDNSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKN 164
            ||..:.....||....|...:....:|.|:.|...:.|.:.|.|.|.||:|:|.||.||||.|||
 Frog   261 NLPKVTLPNYDNIPGNLMLASLGMKLGDRILLDAEKAGTLRFCGTTEFASGQWVGVELDEPEGKN 325

  Fly   165 DGCVSGKRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSP-----DRSRTV-----SPTA 219
            ||.|.|.|||.|.||:|||:.:::::..|   .|.|:|  ..|:|     |.||..     ...|
 Frog   326 DGSVGGIRYFICPPKQGIFAPVSKISKAP---DQPPSS--VTSTPRTPRVDFSRVTGKGRKEKKA 385

  Fly   220 SIRSSMLRSPGIGGKNGMA--VGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKND 282
            :.:.|:  |.|...|.|:.  :||:|:|:   |.:.|.:|:.|:|.||||.|.|:||::|:||:|
 Frog   386 THKKSL--SVGSLDKEGLKIDIGDQVLVA---GQKQGFVRFYGKTDFAPGYWFGIELEKPTGKHD 445

  Fly   283 GTVDDIRYFECKPKYGVFVPIAKVSLSPSSKKTRLSRTGSRESLTSIGTMNSIATTATSRMRMNA 347
            |:|..:|||.|.||:|||.|.::|..:...|..:....|.::       ::.:..|         
 Frog   446 GSVFGVRYFTCSPKHGVFAPPSRVQRTGGPKDPQTDNNGMKK-------VHQVTMT--------- 494

  Fly   348 QQRKSSTPVKPILATPK---SQFSMQDLL 373
            |.:::.|.|:    |||   |:.|:..||
 Frog   495 QPKRNFTTVR----TPKEIASENSISRLL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CLIP-190NP_001368962.1 PHA03307 <2..>118 CDD:223039 5/17 (29%)
CAP_GLY 125..189 CDD:396049 33/63 (52%)
CAP_GLY 239..306 CDD:396049 33/66 (50%)
SMC_prok_B <546..912 CDD:274008
Smc 734..1591 CDD:224117
SHE3 1502..1702 CDD:293683
CLIP1_ZNF 1773..1789 CDD:406934
clip3NP_001120145.1 ANK repeat 110..147 CDD:293786
Ank_2 112..218 CDD:372319
ANK repeat 149..185 CDD:293786
ANK repeat 187..218 CDD:293786
CAP_GLY 286..350 CDD:366568 33/63 (52%)
CAP_GLY 405..469 CDD:366568 33/66 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D463666at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1398
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.