DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrch and f-cup

DIOPT Version :9

Sequence 1:NP_609834.2 Gene:Lrch / 35041 FlyBaseID:FBgn0032633 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster


Alignment Length:614 Identity:141/614 - (22%)
Similarity:220/614 - (35%) Gaps:179/614 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEVTTFAFLETLLLY 130
            ||:::       .|.:::.||...||  ..|||.:....::|.|.|.||..:::....||.|...
  Fly   201 LEKLV-------RLNVSHNKLSQLPR--AMYSLPELRHLNISYNEFVELNPDISDLHMLEFLDGG 256

  Fly   131 HNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFL-PLQVLLVSNNRLTSLPDELGRL----- 189
            ||.|:|:|..:..|..||.|.|..|.:..||.::..: .||.:.:.:|.|||||:::|.|     
  Fly   257 HNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDC 321

  Fly   190 ----------------DQTLTDLDASYNQLANLP-ARLGELRSLRSLSLRSNHLLYLPRELTCL- 236
                            ::.|.:|.||.|.:..:| |....|..|:.|.||.|.:..||.|| || 
  Fly   322 LYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDEL-CLL 385

  Fly   237 -SLISLDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDEKG 300
             :|..||||||.|:.||:.:..::.|:.||:|.||:.:....:...|...:.|.|..:|.  .|.
  Fly   386 RNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPIKTIRRDILQCGTTRILKTLHDRAV--AKA 448

  Fly   301 SRSGGNYDGYTTLRRAPRHNSSGNVLEASTTG--STNNQRRHQVDSGYNTSDGLDKRWSHDAPTK 363
            ...||..|                  :|||:.  |....|..|:|.|                  
  Fly   449 KEEGGGVD------------------DASTSAGISVTRLRGGQMDDG------------------ 477

  Fly   364 SKTDSPLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASPCKLSYAHS 428
                            .:|...|.:.|.|.                     ......|..||   
  Fly   478 ----------------DIPGNFPDSFHHQQ---------------------QQNGFQCPCSY--- 502

  Fly   429 NSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQRNQEISVYKQKHPN 493
                    |.|...:   .|:..|:       :.|.|.|.|    :...|.|..|...|:|:|.|
  Fly   503 --------PCQQQQM---QQQFCVY-------EPLRNCQEY----DRQTQGRIYEPENYQQQHQN 545

  Fly   494 AN----------------------HSPNDDEDLS-PSPPSISNGSSSNTLPKSIMK-QNSNQIGH 534
            .:                      :.....:..| ...||    |.|...|:.:.| :::..:..
  Fly   546 GSLRSLFVQQQQQRMEYPYPGYFMYQQQQQQQFSYEQDPS----SRSAVHPRWVYKLRHTRTLAV 606

  Fly   535 NGNGNGS--------ANGNGVDDVVIPKKPIQKVIPSRITEIKPASTSDIRSANSSDCLGYVKPQ 591
            |.....|        |...||..|...:..: ..:|:.:..:|...|..:.|.|   .:|||...
  Fly   607 NLEELTSVPDQVFQIARDEGVHVVDFARNQL-STLPNGLQHMKDLVTELVLSNN---VIGYVPQF 667

  Fly   592 SPMKNGTSKFNTSNG--GGVQTTVGIVSS 618
            .......|..|.||.  ..:.|..|::::
  Fly   668 ISQFTRISFLNLSNNLLNDLPTEFGVLNT 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrchNP_609834.2 LRR_8 124..179 CDD:290566 19/55 (35%)
LRR_4 124..161 CDD:289563 14/36 (39%)
leucine-rich repeat 124..146 CDD:275380 9/21 (43%)
leucine-rich repeat 147..167 CDD:275380 7/19 (37%)
leucine-rich repeat 169..192 CDD:275380 10/43 (23%)
leucine-rich repeat 193..215 CDD:275380 8/22 (36%)
leucine-rich repeat 216..237 CDD:275380 11/22 (50%)
leucine-rich repeat 238..260 CDD:275380 10/21 (48%)
leucine-rich repeat 261..279 CDD:275380 6/17 (35%)
CH 676..756 CDD:214479
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380
LRR_RI 155..>377 CDD:238064 54/184 (29%)
leucine-rich repeat 158..180 CDD:275380
LRR_8 180..235 CDD:290566 11/42 (26%)
leucine-rich repeat 181..203 CDD:275380 1/1 (100%)
leucine-rich repeat 204..226 CDD:275380 8/30 (27%)
LRR_8 225..283 CDD:290566 19/57 (33%)
leucine-rich repeat 227..249 CDD:275380 5/21 (24%)
leucine-rich repeat 250..272 CDD:275380 9/21 (43%)
LRR_8 272..329 CDD:290566 17/56 (30%)
leucine-rich repeat 273..295 CDD:275380 7/21 (33%)
leucine-rich repeat 296..318 CDD:275380 10/21 (48%)
LRR_8 317..375 CDD:290566 13/57 (23%)
leucine-rich repeat 319..340 CDD:275380 0/20 (0%)
leucine-rich repeat 341..364 CDD:275380 8/22 (36%)
leucine-rich repeat 389..410 CDD:275380 9/20 (45%)
leucine-rich repeat 411..430 CDD:275380 6/18 (33%)
leucine-rich repeat 627..650 CDD:275380 4/23 (17%)
leucine-rich repeat 651..669 CDD:275380 6/20 (30%)
leucine-rich repeat 697..719 CDD:275380 141/614 (23%)
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.