DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrch and CG3494

DIOPT Version :9

Sequence 1:NP_609834.2 Gene:Lrch / 35041 FlyBaseID:FBgn0032633 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster


Alignment Length:219 Identity:72/219 - (32%)
Similarity:105/219 - (47%) Gaps:23/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 FPRTGTKYSLTDTVIADLSRNRFAELPEEVTTFA---FLETLLLYHNTIRSIPESVKQLSS-LTY 149
            ||   .||.:.:|.|..:|:.:.:|:|.||...|   .:..:.|..|.:..:|:.:..||. ||.
  Fly    28 FP---DKYHMRNTRILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQ 89

  Fly   150 LDLRSNQLSSLPREIC-FLPLQVLLVSNNRLTSLPDELGRLDQTLTDLDASYNQLANLPARLGEL 213
            |.|..||:|.:|..|. :..|..|.:|||.|..||.|||.| :.|.:||.|:|:...||..:.||
  Fly    90 LVLNKNQISFVPTNISQYSKLTNLSLSNNLLCDLPMELGGL-RLLRNLDISHNRFRQLPRCIYEL 153

  Fly   214 RSLRSLSLRSNHLLYLP---------RELTCLSLISLDVSNNKIASLPLEIRHMSTLVELQLENN 269
            ..|.:||...|.:..:.         |||..|:|     .||.|..:|..:..|..||||:|..|
  Fly   154 ERLETLSAHDNQIRAIDASESGLGGMRELKRLNL-----GNNDIQIVPPILGKMQNLVELELWGN 213

  Fly   270 PLTSPPASLCMRGLVHVFKFLETQ 293
            |...|...:...|...:..:|.|:
  Fly   214 PFRQPRHQILSMGTPALLSYLRTR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrchNP_609834.2 LRR_8 124..179 CDD:290566 19/56 (34%)
LRR_4 124..161 CDD:289563 12/37 (32%)
leucine-rich repeat 124..146 CDD:275380 4/21 (19%)
leucine-rich repeat 147..167 CDD:275380 9/20 (45%)
leucine-rich repeat 169..192 CDD:275380 12/22 (55%)
leucine-rich repeat 193..215 CDD:275380 9/21 (43%)
leucine-rich repeat 216..237 CDD:275380 7/29 (24%)
leucine-rich repeat 238..260 CDD:275380 6/21 (29%)
leucine-rich repeat 261..279 CDD:275380 8/17 (47%)
CH 676..756 CDD:214479
CG3494NP_611915.1 LRR <34..>231 CDD:227223 66/202 (33%)
leucine-rich repeat 38..62 CDD:275380 7/23 (30%)
leucine-rich repeat 63..86 CDD:275380 5/22 (23%)
LRR_4 85..124 CDD:289563 15/38 (39%)
leucine-rich repeat 87..109 CDD:275380 9/21 (43%)
leucine-rich repeat 110..133 CDD:275380 12/23 (52%)
leucine-rich repeat 134..155 CDD:275380 8/20 (40%)
leucine-rich repeat 156..181 CDD:275380 4/24 (17%)
leucine-rich repeat 182..204 CDD:275380 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.