DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lrch and CG10307

DIOPT Version :9

Sequence 1:NP_609834.2 Gene:Lrch / 35041 FlyBaseID:FBgn0032633 Length:1135 Species:Drosophila melanogaster
Sequence 2:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:417 Identity:96/417 - (23%)
Similarity:163/417 - (39%) Gaps:92/417 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 IADLSRNRF--AELPEEVTTFAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREI- 164
            :....||.:  |...:.:...||  :|.|.|..|..:|..:::..:|..|.|..|:|:.:|..| 
  Fly     4 VCQFFRNNYVLANCEDAIYKKAF--SLNLSHYQISDVPGIIEKCETLMKLFLNQNKLTKIPSSIG 66

  Fly   165 CFLPLQVLLVSNNRLTSLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYL 229
            ..:.||||.:..|:|...|..:.||.: |..|:.|.|.:::||..||.|..|.:....:..||.|
  Fly    67 SLMRLQVLTLDYNKLDEFPLCICRLVR-LKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLEL 130

  Fly   230 PREL-TCLSLISLDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRG-LVHVFKFLET 292
            |.|: .|..|.:|.|..|.:..||..|..:|:|..|..|...|:..|.::.:.| |||:      
  Fly   131 PNEIRNCEHLETLGVRGNPLKKLPDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHL------ 189

  Fly   293 QATKDEKGSRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWS 357
                :.||:|          |||.||...:...|..:.                     |::...
  Fly   190 ----NLKGNR----------LRRLPRMLMAMQKLRFAF---------------------LNENCI 219

  Fly   358 HDAPTKSKTDS--PLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASP 420
            .:.||:|:.:.  .||.::.|..       |.::|....||....|         :|.:...:.|
  Fly   220 DEMPTRSQLEELRTLHMLNLSKN-------PISLHRDLQLMALRQT---------NLYVELPSDP 268

  Fly   421 CKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQRNQEIS 485
            ..:....::.:|..:...|:|                 ..:|.|......::..::   |..|:.
  Fly   269 ANICDGLASRASLNAQEQQED-----------------QARGAGQDLDSSDWANSV---RTSELD 313

  Fly   486 VYKQKHPNANHSPNDDEDLSPSPPSIS 512
            .     .:.:...|:.||||...|.:|
  Fly   314 T-----TDESALENNIEDLSVMLPEMS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LrchNP_609834.2 LRR_8 124..179 CDD:290566 17/55 (31%)
LRR_4 124..161 CDD:289563 10/36 (28%)
leucine-rich repeat 124..146 CDD:275380 5/21 (24%)
leucine-rich repeat 147..167 CDD:275380 7/20 (35%)
leucine-rich repeat 169..192 CDD:275380 9/22 (41%)
leucine-rich repeat 193..215 CDD:275380 9/21 (43%)
leucine-rich repeat 216..237 CDD:275380 7/21 (33%)
leucine-rich repeat 238..260 CDD:275380 7/21 (33%)
leucine-rich repeat 261..279 CDD:275380 5/17 (29%)
CH 676..756 CDD:214479
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 5/16 (31%)
LRR_8 47..104 CDD:290566 20/57 (35%)
leucine-rich repeat 48..70 CDD:275380 7/21 (33%)
LRR 69..>244 CDD:227223 58/223 (26%)
leucine-rich repeat 71..93 CDD:275380 9/21 (43%)
leucine-rich repeat 94..116 CDD:275380 9/21 (43%)
leucine-rich repeat 117..139 CDD:275380 7/21 (33%)
leucine-rich repeat 140..162 CDD:275380 7/21 (33%)
leucine-rich repeat 163..185 CDD:275380 5/21 (24%)
leucine-rich repeat 186..208 CDD:275380 11/41 (27%)
leucine-rich repeat 209..233 CDD:275380 5/44 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.