DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and GLC8

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_014042.1 Gene:GLC8 / 855359 SGDID:S000004928 Length:229 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:29/105 - (27%)
Similarity:43/105 - (40%) Gaps:34/105 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KDYGHMIIDEPKTPF----------------VFEEDLPK--------ELDTNALIEKLRHTSKSE 80
            |.:..:.|||||||:                ..|::..|        ::|..:|.|......:::
Yeast   106 KQFQDIHIDEPKTPYQGAVDPHGEYYRVDDDEDEDNSDKKPCQVANDDIDDLSLGEPEFEIKENK 170

  Fly    81 MPAFGIEGDSEESSADEDFPESVEEKVRRMEFERRRKVHY 120
            .|.|  |.:.|.   |||.||:     |..:||..||.||
Yeast   171 QPDF--ETNDEN---DEDSPEA-----RHKKFEEMRKKHY 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 29/105 (28%)
GLC8NP_014042.1 IPP-2 91..201 CDD:398578 29/105 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.