DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and PPP1R2C

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_079486.1 Gene:PPP1R2C / 80316 HGNCID:16324 Length:202 Species:Homo sapiens


Alignment Length:207 Identity:54/207 - (26%)
Similarity:89/207 - (42%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILK----SGNN---SAQFS---------LKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPF 54
            :|||||    ||::   |.|.|         .|:.|:||.:|||......:||..|..:||.|.:
Human    11 IKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATYRDYDLMKANEPGTSY 75

  Fly    55 VFEEDLPKELDTNALIEKLRHTSKSEMPAFGIEG----DSEESSADEDFPESVEEKVRRM----- 110
            :..:|..:        :.:|.. :.|....|:||    |:.:.|.:.|..||.|..:|::     
Human    76 MSVQDNGE--------DSVRDV-EGEDSVRGVEGKEATDASDHSCEVDEQESSEAYMRKILLHKQ 131

  Fly   111 ----EFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCEGGMESCEACSENNQLDGEASN 171
                :||.||::||.|..::.|||:|:..|..                     ||:|:.:.....
Human   132 EKKRQFEMRRRLHYNEELNIKLARQLMWKELQ---------------------SEDNENEETPQG 175

  Fly   172 LTQTKYSYSESQ 183
            ..:.|.:..||:
Human   176 TNEEKTAAEESE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 36/123 (29%)
PPP1R2CNP_079486.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 14/39 (36%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 6/11 (55%)
IPP-2 45..170 CDD:309902 40/154 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..118 11/55 (20%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 144..147 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..202 6/47 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm8624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.