DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and PPP1R2C

DIOPT Version :10

Sequence 1:NP_609833.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_079486.1 Gene:PPP1R2C / 80316 HGNCID:16324 Length:202 Species:Homo sapiens


Alignment Length:207 Identity:54/207 - (26%)
Similarity:89/207 - (42%) Gaps:59/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILK----SGNN---SAQFS---------LKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPF 54
            :|||||    ||::   |.|.|         .|:.|:||.:|||......:||..|..:||.|.:
Human    11 IKGILKNKSSSGSSVATSGQQSGGTIQDVKRKKSQKWDESSILAAHRATYRDYDLMKANEPGTSY 75

  Fly    55 VFEEDLPKELDTNALIEKLRHTSKSEMPAFGIEG----DSEESSADEDFPESVEEKVRRM----- 110
            :..:|..:        :.:|.. :.|....|:||    |:.:.|.:.|..||.|..:|::     
Human    76 MSVQDNGE--------DSVRDV-EGEDSVRGVEGKEATDASDHSCEVDEQESSEAYMRKILLHKQ 131

  Fly   111 ----EFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCEGGMESCEACSENNQLDGEASN 171
                :||.||::||.|..::.|||:|:..|..                     ||:|:.:.....
Human   132 EKKRQFEMRRRLHYNEELNIKLARQLMWKELQ---------------------SEDNENEETPQG 175

  Fly   172 LTQTKYSYSESQ 183
            ..:.|.:..||:
Human   176 TNEEKTAAEESE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_609833.1 IPP-2 24..136 CDD:461504 36/124 (29%)
PPP1R2CNP_079486.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 14/39 (36%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 6/11 (55%)
IPP-2 45..170 CDD:461504 40/154 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..118 11/55 (20%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 144..147 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..202 6/47 (13%)

Return to query results.
Submit another query.