DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and 2810408A11Rik

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001369390.1 Gene:2810408A11Rik / 70419 MGIID:1917669 Length:456 Species:Mus musculus


Alignment Length:362 Identity:83/362 - (22%)
Similarity:139/362 - (38%) Gaps:109/362 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQVKGILKSGNNSAQFSL--------KAAKFDEVNILATFHPAGKDYGHMIIDEPKTPFVFEEDL 60
            ::.:.|||   ||:...:        |:.::||:|||||:|||.||||.|..|||:||:...:|.
Mouse   128 ERPRSILK---NSSSILIKKPPGSEKKSQRWDEMNILATYHPADKDYGFMKADEPRTPYHRLQDT 189

  Fly    61 PKELDTNALIEKLRHTSKSE--------MPAFGIEGDSEESSADEDFPESVEEKVRRMEFERRRK 117
            .::....:.: |:...|.:|        :|.....||::.|...::|     .|....:|::.||
Mouse   190 DEDPSAESSL-KVTPQSVAERFATMDNFLPKVLQYGDNKNSKDTDNF-----AKTYSSDFDKHRK 248

  Fly   118 VHYKEFYSVPLARRLIADE-----FAELTSSEFNI-------HCEGG------------------ 152
            :||.|...:...:.|..:|     .|.::||...:       ..|.|                  
Mouse   249 IHYSEGKFLKSPKNLPTEEESIGASASISSSNQAVATDLKPRPVEKGWAGRLATGVKNDTVLMTD 313

  Fly   153 ---MESCEACSENNQLD-------GEASNLTQTKYSYSESQSEYRISDHSEPEPGFSPSHHCYQK 207
               :.:.::.:..||..       |:.:||.:.:| ||:.:   .:...|.||.|          
Mouse   314 SHVLSTNDSATYRNQFPSASDSSMGQLANLQRKEY-YSKGR---YLRSGSRPELG---------- 364

  Fly   208 LKAELFSKAEPEELASLTHLHRMPS---VNDDEP-----SREPRVPYPSVVPTQTQNLHEHKSSL 264
               |.....|.:..:.||.:...|.   ||..:.     ::.||...|.      .:..||.|  
Mouse   365 ---EDIEDEEQDSPSGLTWVTENPKGTPVNGSQVTPNCWAKGPRCRSPG------SSEKEHGS-- 418

  Fly   265 KITSEKPTPARICKSNPDNRPG--------TSKKETR 293
               ::.|......:..|..|.|        |.|||.|
Mouse   419 ---NQNPPSWNGRRREPGPRQGDESLRLQWTQKKERR 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 37/118 (31%)
2810408A11RikNP_001369390.1 IPP-2 153..268 CDD:398578 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8857
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.