DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and LOC497940

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_006246839.1 Gene:LOC497940 / 497940 RGDID:1563007 Length:460 Species:Rattus norvegicus


Alignment Length:306 Identity:73/306 - (23%)
Similarity:120/306 - (39%) Gaps:68/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILKSGNNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPF----VFEEDLPKELDTNAL 69
            ::|..:||.:   |:.::||:|||||:|||.||||.|..|||:||:    ..:||...|......
  Rat   140 LIKKPSNSEK---KSQRWDEMNILATYHPADKDYGFMKADEPRTPYHRLQDNDEDPSAESSLKVT 201

  Fly    70 IEKLRH---TSKSEMPAFGIEGDSEESSADEDFPESVEEKVRRMEFERRRKVHYKEFYSVPLARR 131
            .|.:..   |..:.:|.....||::.|...::|     .|....:|::.||:||.|...:...:.
  Rat   202 PESVAERFATMDNFLPKVLQYGDNKNSKTTDNF-----TKTHSTDFDKHRKIHYSEGKYLKTPKN 261

  Fly   132 LIADEFAELTSSEFNIHCEGGMESCEACSENNQLD--------GEASNLTQTKYSYSESQSEYRI 188
            |.:....|.|         |...|..:.::...:|        |.|..|.........|.::..:
  Rat   262 LPSATEEENT---------GAGASIGSSNQGVAVDLKSRPVEKGWAGRLATGVRKDGVSMADSYV 317

  Fly   189 SDHSE--------PEPGFSPSHHCYQKLKAELFSKAEPEELASLTHLHRMPSVNDDEPSREPRVP 245
            .|.::        |....|.........:.|.:||.  ..|.|.:|    |.:.:|....|..: 
  Rat   318 LDTNDSATYKNQFPSASDSTVGELATLQRKEYYSKG--RYLRSCSH----PELGEDIEDEEQDI- 375

  Fly   246 YPSVVPTQTQNLHEHKSSLKITSEKPTPARICKSNPDNRPGTSKKE 291
                            |..:::|......|.|:|     ||:|:||
  Rat   376 ----------------SGSQVSSNCWAKGRRCRS-----PGSSEKE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 38/117 (32%)
LOC497940XP_006246839.1 IPP-2 152..257 CDD:282789 37/109 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9103
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.