DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and ppp1r2

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_991231.1 Gene:ppp1r2 / 402967 ZFINID:ZDB-GENE-040426-1814 Length:204 Species:Danio rerio


Alignment Length:177 Identity:62/177 - (35%)
Similarity:88/177 - (49%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILKSG---------------------NNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDE 49
            :|||||:.                     |:......|:.|:||:|||||:|||.||||.|.|||
Zfish     7 IKGILKNKSSIKVRAEEPVQDIPEPGAPLNSEDDPQKKSQKWDEMNILATYHPADKDYGLMKIDE 71

  Fly    50 PKTPF---VFEEDLPKELDTNALIEKLRHTS------KSEMPAFGIEG--------DSEESSADE 97
            |.||:   |.:|:     |..||.:...:|:      ..::.|...||        ..||||.:|
Zfish    72 PSTPYHRMVGDEE-----DEGALSDSEGNTALPGDDLAQKLAAAAAEGAESRFMQEPEEESSEEE 131

  Fly    98 DFPESVEEKVRRMEFERRRKVHYKEFYSVPLARRLIADEFAELTSSE 144
            :...|.||:.|:.:|:..||:||.|..::.|||:|||:|..|....|
Zfish   132 EEELSPEEQARKKQFQMMRKMHYNEGMNIKLARQLIANELEEEDEDE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 51/127 (40%)
ppp1r2NP_991231.1 IPP-2 46..169 CDD:282789 51/127 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7112
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - otm26433
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.