DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and I-2

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001097564.1 Gene:I-2 / 39156 FlyBaseID:FBgn0028429 Length:310 Species:Drosophila melanogaster


Alignment Length:204 Identity:82/204 - (40%)
Similarity:114/204 - (55%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KGILKSG----NNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPFVFEEDLPK---EL 64
            |||||:.    .:.|.|. |:|||||:|::.|||||.||||||.|||||||:.:.|...:   ||
  Fly   117 KGILKTSRSFDKSGASFR-KSAKFDELNVMQTFHPADKDYGHMKIDEPKTPYNYTEGFDENRDEL 180

  Fly    65 DTNALIEKLRHTSKSEMPAFGIEGDSEESSADEDFPESVEEKVRRMEFERRRKVHYKEFYSVPLA 129
            ||..|:||||..:.::.....||.|   .|:.:|.|.|.||:.||.|||||||.||:||.:|.||
  Fly   181 DTELLVEKLRIAANTQPSTESIEDD---GSSGDDQPLSEEERQRRREFERRRKAHYREFEAVKLA 242

  Fly   130 RRLIADEFAELTSSEFNIHCEGGMESCEACSENNQLDGEASNLTQTKYSYSESQSEYRISDHSEP 194
            |:||.:|     ..:.:...:|........|:.....|..:: :.||.|.|::.|....|..:..
  Fly   243 RKLIQEE-----DDDDDDEDKGADSRPSGSSQGASSSGRFAS-SSTKRSSSQADSTTSPSTSAGQ 301

  Fly   195 EPGFSPSHH 203
            .....||::
  Fly   302 NMDLEPSNN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 62/113 (55%)
I-2NP_001097564.1 IPP-2 137..247 CDD:282789 61/112 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470275
Domainoid 1 1.000 98 1.000 Domainoid score I7112
eggNOG 1 0.900 - - E1_KOG4041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - otm26433
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - P PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
1110.700

Return to query results.
Submit another query.