DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and CG12620

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster


Alignment Length:289 Identity:88/289 - (30%)
Similarity:126/289 - (43%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KAAKFDEVNILATFHPAGKDYGHMIIDEPKTPFVFEEDLPKELDTNALIEKLRHTSKSEMPAFGI 86
            |..:||::|:....|....:     ::......:..|...|.:....|:|||....|...|.|..
  Fly     4 KRTRFDKMNLGVPVHSDPYE-----VENESASSIKRETGEKVMSHKELMEKLHKEVKLTTPDFFA 63

  Fly    87 EGDSEESSADEDFP--ESVEEKVRRMEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIH- 148
            ...|..|...|||.  |:::|:.||:.|.||||:||.||.:|.||||||.:||.|.:.|:.::. 
  Fly    64 HDPSCSSDDSEDFEFLETIKERARRISFVRRRKLHYTEFSTVELARRLIREEFTESSESQLSVDD 128

  Fly   149 ---CEGGMESCEACSENNQLDGEASNLTQTKYSYSESQSEYRISDHS----EPEPGFSPSHHCYQ 206
               .|...|.|..|       |..|:.....:.|..:..:..|||.|    :|||||.|:||||.
  Fly   129 EHISEIAEEECPPC-------GTDSDDLLPYFQYDRATDQSMISDDSLPKEDPEPGFHPAHHCYN 186

  Fly   207 KLKAE------LFSKAEPEELASLTHLHRMPSVNDDEPSREPRV-PYPSVVPTQTQNLHEHKSSL 264
            ||.::      ::..||||.              ..||..||.| |.|...|..     |.::.|
  Fly   187 KLISQTPDPPIVYVPAEPEP--------------QPEPQPEPPVEPRPEPEPEP-----EPETVL 232

  Fly   265 KITSEKPTPARICKSNPDNRPGTSKKETR 293
            ..|:    |..|.|:.|:     .:|.||
  Fly   233 PPTA----PEVIDKTAPE-----EEKHTR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 38/112 (34%)
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.