DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and SPAC17A5.09c

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_593477.1 Gene:SPAC17A5.09c / 2542189 PomBaseID:SPAC17A5.09c Length:310 Species:Schizosaccharomyces pombe


Alignment Length:271 Identity:54/271 - (19%)
Similarity:91/271 - (33%) Gaps:77/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LRHTSKSEMPAFGIEGDSEESSADEDFPESV-----------------EEKVRRM---------- 110
            |:|   |.|.:..:|.||.||...::...|.                 ||::||:          
pombe     7 LKH---SRMSSPSLETDSMESGQQQNMVSSTPSIDMNESDCSGTGTPSEERIRRLRWDEENLSKA 68

  Fly   111 EFERRRKVHYKEFYSVPLARRLIA-DEFAELTSSEFNIHCE----------GGMESCEACSENNQ 164
            |.::..|:...| ...|..|.|:. ||..|:...|.:...:          |.:.|.....::. 
pombe    69 EQQKSAKMKITE-PKTPFQRFLLPDDEVPEINLDETDSKDDFTAGTLGDTLGTLPSTRVSKDSK- 131

  Fly   165 LDGEASNLTQTKYSY-------------SESQSEYRISDHSEPEPGFSPSHHCYQKLKAELFSKA 216
             |...|..:..|..|             :.|...|.:. ...|.|.:|..:|.  ..|.|||.:.
pombe   132 -DDNVSFSSDKKQFYVKKEPFPVPCTEPTTSGDRYTVR-MKAPTPKYSTDNHL--PSKKELFPRE 192

  Fly   217 EPEELASL--------THLHRMPSVND--DEPSREPRVPYPSVVPTQTQNLHEHKSSLKITSEKP 271
            ...::..:        .||...||||:  .:.....::....|:..:.:.:.|...|   .:|:.
pombe   193 TKPQVEVVHARINNPDDHLRTHPSVNNLGKDSDHADKMYNEGVILGEDEAMEEEALS---EAEEN 254

  Fly   272 TPARICKSNPD 282
            .|    |..||
pombe   255 IP----KKKPD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 20/89 (22%)
SPAC17A5.09cNP_593477.1 IPP-2 58..>133 CDD:282789 12/77 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.