DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and PPP1R2B

DIOPT Version :10

Sequence 1:NP_609833.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_996740.2 Gene:PPP1R2B / 153743 HGNCID:16318 Length:205 Species:Homo sapiens


Alignment Length:231 Identity:70/231 - (30%)
Similarity:105/231 - (45%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILKSGNNSA----------------QFSLKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPF 54
            :|||||:..::.                :.|.|:.|:||:|||||:|||.|.||.|.||||..|:
Human    11 IKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDEPSPPY 75

  Fly    55 VF----EEDLPKELDT------NALIEKLRHTSKSEMPAFGIEGDSEESSADEDFPESVEEKVRR 109
            ..    :||..::.:|      :.|.:||......| |.:.|:  .:|||.:||...|.||:.::
Human    76 HSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLE-PKYRIQ--EQESSGEEDSDLSPEEREKK 137

  Fly   110 MEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCEGGMESCEACSENNQLDGEASNLTQ 174
            .:||.|||:||.|..::.|||:||:.:..:....|         |..|..      |||:.|.  
Human   138 RQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDE---------EMLETA------DGESMNT-- 185

  Fly   175 TKYSYSESQSEYRISDHSEPEPGFSPSHHCYQKLKA 210
                             .|...|.:||.....||::
Human   186 -----------------EESNQGSTPSDQQQNKLRS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_609833.1 IPP-2 24..136 CDD:461504 50/121 (41%)
PPP1R2BNP_996740.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 6/32 (19%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 7/11 (64%)
IPP-2 45..164 CDD:461504 50/121 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..142 12/33 (36%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 147..150 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..205 13/76 (17%)

Return to query results.
Submit another query.