DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and PPP1R2B

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_996740.2 Gene:PPP1R2B / 153743 HGNCID:16318 Length:205 Species:Homo sapiens


Alignment Length:231 Identity:70/231 - (30%)
Similarity:105/231 - (45%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILKSGNNSA----------------QFSLKAAKFDEVNILATFHPAGKDYGHMIIDEPKTPF 54
            :|||||:..::.                :.|.|:.|:||:|||||:|||.|.||.|.||||..|:
Human    11 IKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDEPSPPY 75

  Fly    55 VF----EEDLPKELDT------NALIEKLRHTSKSEMPAFGIEGDSEESSADEDFPESVEEKVRR 109
            ..    :||..::.:|      :.|.:||......| |.:.|:  .:|||.:||...|.||:.::
Human    76 HSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLE-PKYRIQ--EQESSGEEDSDLSPEEREKK 137

  Fly   110 MEFERRRKVHYKEFYSVPLARRLIADEFAELTSSEFNIHCEGGMESCEACSENNQLDGEASNLTQ 174
            .:||.|||:||.|..::.|||:||:.:..:....|         |..|..      |||:.|.  
Human   138 RQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDE---------EMLETA------DGESMNT-- 185

  Fly   175 TKYSYSESQSEYRISDHSEPEPGFSPSHHCYQKLKA 210
                             .|...|.:||.....||::
Human   186 -----------------EESNQGSTPSDQQQNKLRS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 50/120 (42%)
PPP1R2BNP_996740.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 6/32 (19%)
Required for binding PPP1CC. /evidence=ECO:0000250 12..17 4/4 (100%)
Required for binding PPP1CC. /evidence=ECO:0000250 43..55 7/11 (64%)
IPP-2 45..164 CDD:309902 50/121 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..142 12/33 (36%)
Required for binding PPP1CC catalytic center, displacing metal ions and inhibition of PPP1CC catalytic activity. /evidence=ECO:0000250 147..150 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..205 13/76 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - mtm8624
orthoMCL 1 0.900 - - OOG6_106897
Panther 1 1.100 - - O PTHR12398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.