DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6380 and ppp1r2

DIOPT Version :9

Sequence 1:NP_001286009.1 Gene:CG6380 / 35040 FlyBaseID:FBgn0032632 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001163967.1 Gene:ppp1r2 / 100038193 XenbaseID:XB-GENE-479701 Length:187 Species:Xenopus tropicalis


Alignment Length:161 Identity:58/161 - (36%)
Similarity:85/161 - (52%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VKGILK-----------------SGNNSAQFSLKAAKFDEVNILATFHPAGKDYGHMIIDEPKTP 53
            :|||||                 :.:.....|.|:.|:||:|||||:||:.||||.|.||||.||
 Frog     9 IKGILKNKGSEKHGVCVISKPETASDREEDQSKKSQKWDEMNILATYHPSDKDYGLMKIDEPSTP 73

  Fly    54 F-----------VFEEDLPKELDTNALIEKLRHTSKSEMPAFGIEGDSEESSADEDFPESVEEKV 107
            :           :.:.:..::|..:.|.|||.....:: |.|..:   .|||.:|:...:.||:.
 Frog    74 YHRMIGDDDEGAMSDSESNEDLTADVLAEKLAAAEGTD-PKFLAQ---SESSDEEEEELTEEERE 134

  Fly   108 RRMEFERRRKVHYKEFYSVPLARRLIADEFA 138
            :|.|||.:||.||.|..::.|||:|||.|.|
 Frog   135 KRKEFEMKRKHHYNEGMNIKLARQLIAKELA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6380NP_001286009.1 IPP-2 24..135 CDD:282789 48/121 (40%)
ppp1r2NP_001163967.1 IPP-2 44..158 CDD:368219 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6358
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 1 1.000 - - FOG0003529
OrthoInspector 1 1.000 - - otm48615
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2894
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.