DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-VI

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001263035.1 Gene:beat-VI / 43377 FlyBaseID:FBgn0039584 Length:332 Species:Drosophila melanogaster


Alignment Length:225 Identity:75/225 - (33%)
Similarity:114/225 - (50%) Gaps:23/225 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPPAQTF 81
            |||.::.        :|..|:.|.||.|.|.|||:..|||:|:||....||||||||:..|...|
  Fly    52 LKDLKIF--------VPEAVLMGNAATLSCQYDLEQAALYAVRWYFGQEEFYRYVPREAKPTFVF 108

  Fly    82 LLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISG 146
            .:.|:||||.||....|||:.|..:.:|.::||||.:||.|.|......|.|..||.: .|.:..
  Fly   109 AVAGINVDLANSDATSVTLKGVTRELSGSYQCEVSEDAPLFHTEIRSAHMQVIELPKD-DPVMQV 172

  Fly   147 GRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRK-----YD--TIVSGRDGLETSVL 204
            .:....:.|..:..||.|.|.|...::|.:||..:.:..|::     |:  |..|..| :..:..
  Fly   173 DKKVIGVNDNFKAVCTVGPSYPPANITWSINGNQIRRTPLQRISQDTYEGSTTYSSLD-IYPNSQ 236

  Fly   205 GLQ--FRVEQKHFRKGNMKLKCIAELSTVY 232
            .||  |..:.:|    ::.|:|:..:..:|
  Fly   237 ALQGFFETKYQH----SVNLQCVVTIRHMY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 46/93 (49%)
Ig 42..127 CDD:143165 42/84 (50%)
Ig 140..219 CDD:299845 19/87 (22%)
beat-VINP_001263035.1 Ig 66..142 CDD:416386 37/75 (49%)
Ig strand B 67..76 CDD:409353 4/8 (50%)
CDR1 76..83 CDD:409353 3/6 (50%)
Ig strand C 83..91 CDD:409353 4/7 (57%)
FR2 84..91 CDD:409353 3/6 (50%)
CDR2 94..108 CDD:409353 8/13 (62%)
Ig strand C' 94..99 CDD:409353 4/4 (100%)
Ig strand C' 102..104 CDD:409353 0/1 (0%)
FR3 109..143 CDD:409353 14/33 (42%)
Ig strand D 117..121 CDD:409353 2/3 (67%)
Ig strand E 123..127 CDD:409353 1/3 (33%)
Ig strand F 136..144 CDD:409353 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.