DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-IV

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster


Alignment Length:234 Identity:102/234 - (43%)
Similarity:149/234 - (63%) Gaps:8/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLPGVNVDLHNSSDAI-VTLRNVNLQSAGRFRCE 114
            :|||||::|||||..|||||||:..||..::.:.||.| :...|||. |.||.:.|.|.|.:|||
  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRV-IEELSDASRVLLRGLTLNSTGLYRCE 270

  Fly   115 VSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGE 179
            ||.|||:|.:|...|.|.:.:||.:| |.|.|.:.:||||:|:.:|||:|:|.||..|.|.||.:
  Fly   271 VSAEAPNFSSVQGEGRMDIVFLPRDG-PHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQ 334

  Fly   180 PV-EQQKLRKYDTIVSGRDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGD 243
            |: ::..|.||:.||. :.||.||.||||..:|.:||.:|:|::||:|.:|.|.|:..:|||...
  Fly   335 PILDEHYLHKYNDIVH-KHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESVLQR 398

  Fly   244 RPQKAPVLESRETVYASNSRADPVQGTSYRELFVTKILS 282
            ||   .::::||.:......|...:.:..|.|.:..||:
  Fly   399 RP---GIIDNREAMLLVKGAAGHSESSFLRTLTIAIILA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 41/76 (54%)
Ig 42..127 CDD:143165 41/76 (54%)
Ig 140..219 CDD:299845 37/79 (47%)
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 37/73 (51%)
Ig 314..>362 CDD:299845 23/48 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113977at6656
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.