DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-IIb

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster


Alignment Length:359 Identity:102/359 - (28%)
Similarity:153/359 - (42%) Gaps:86/359 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLAALFFIGTLKDFRVAGLRLTEVRI-PMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRY 70
            ||..||.     ||..|.||...:.: |..|.:|.:..|.|.|.|....|||:|:|:...|||||
  Fly    83 LLLCLFC-----DFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRY 142

  Fly    71 VPRDMPPAQTFLLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAY 135
            .|.:.||.:.|..||:.||.:.|:...|.:|||:...:|:|.|||:.:||.:.|.|....|.|..
  Fly   143 TPGEYPPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQVVE 207

  Fly   136 LPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPV------EQQKLRKYDTIVS 194
            .| |..|::.....||:.||.:|.||:...|:|...|.:.:|..||      |.|.:|..|::::
  Fly   208 FP-EKRPQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPFTEETQYIRTVDSLIA 271

  Fly   195 GRDGLETSVLGLQFRVEQKHF--------------------------------------RKGNMK 221
            .|       |.|:.:::..||                                      ..|.:.
  Fly   272 SR-------LSLKLQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGGGGGGAGGGGLI 329

  Fly   222 LKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETVYASNSRADPVQGTSYRELFVTKILSLLFV 286
            |:|.|::..:|....|  :|...|||.|| .:|.|:.:         ||..|....|..      
  Fly   330 LRCTAQIGDLYQEYKE--IELGTPQKDPV-PARVTLSS---------GTGLRGFLETYF------ 376

  Fly   287 QPNAASSTASAPS----TPITPLVLLPVALAVMV 316
                  :|:|.||    :.....:.||.|||.::
  Fly   377 ------ATSSGPSNWRGSAGVVAIFLPTALAQLI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 38/93 (41%)
Ig 42..127 CDD:143165 35/84 (42%)
Ig 140..219 CDD:299845 23/122 (19%)
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.