DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-Va

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:273 Identity:87/273 - (31%)
Similarity:134/273 - (49%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FGHLSLLAALFFIGTLKDFRVA-GLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGN 65
            :|.|..|    ||..|.|:.:| .|.:|::.:|..|.......|.|.||:.|..|.|||||||..
  Fly     3 YGWLMFL----FIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHE 63

  Fly    66 EFYRYVPRDMPPAQTFLLPGVNV----DLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVT 126
            ||:||.|...|...||.:.|:.|    .:.|.|...:.|.....:|.|.::|||||:||.|:...
  Fly    64 EFFRYSPLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLAD 128

  Fly   127 EHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGE-PVEQQKLRKYD 190
            :..:|.||.|| :..|.|......|::.:|::..|.:..|....:|:|.:||| |:..:.....|
  Fly   129 KADNMTVAALP-QNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTTD 192

  Fly   191 TIVSGRD-GLETSVLGLQFRVE-QKHFRKGN-MKLKCIAELSTVYWRCNEESVEGDRPQKAPVLE 252
            |.::..| .|....|.:||.:: |:.|:.|. ::|||:||:                 :..|.|.
  Fly   193 TSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEI-----------------ENYPELR 240

  Fly   253 SRETVYASNSRAD 265
            ..:|:.||.|:.|
  Fly   241 REKTLSASLSQYD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 38/97 (39%)
Ig 42..127 CDD:143165 36/88 (41%)
Ig 140..219 CDD:299845 21/81 (26%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.