DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and CG5597

DIOPT Version :10

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:213 Identity:45/213 - (21%)
Similarity:83/213 - (38%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQ---LECLYDLDGEALY-SVKWYKDGNE 66
            :||.|:..||.|....:......|....:.|::....:   |:|.|:::....: :||||:|...
  Fly     3 TLLIAILAIGLLHRDALCYPTRDESEDKIIVLQNEEMEPTILDCDYEVEESPKFITVKWYRDDKS 67

  Fly    67 FYRYVPRDMPPAQTFLLPGVNVDLHNSSDAI-------------VTLRNVNLQSAGRFRCEVSGE 118
            .|::: ...||   :.:|    :..|..|:.             :.|.|..:.:.|.::|.|.  
  Fly    68 IYQWI-FGTPP---YAIP----EFRNEIDSTYESSTEPSKQYSSLALINPTIATTGDYKCVVQ-- 122

  Fly   119 APSFQTVTEHGDMIVAYLPD---EGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEP 180
             .|..|.:.|..:.|..|.:   |.|.|        .|.:..::|||.....|...::...|...
  Fly   123 -TSLNTFSSHQRVQVIDLRNYTLELSHK--------TIHNETQLNCTVTNVYPRPTITIISNDMD 178

  Fly   181 VEQQKLRKYDTIVSGRDG 198
            |.:::...|:......||
  Fly   179 VVKREPMVYENEEGYFDG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 22/110 (20%)
Ig strand B 42..46 CDD:409353 1/6 (17%)
Ig strand C 57..61 CDD:409353 2/3 (67%)
Ig strand E 96..100 CDD:409353 0/16 (0%)
Ig strand F 110..115 CDD:409353 1/4 (25%)
Ig 140..>194 CDD:472250 10/53 (19%)
Ig strand B 157..161 CDD:409353 0/3 (0%)
Ig strand C 171..174 CDD:409353 0/2 (0%)
CG5597NP_611841.1 None

Return to query results.
Submit another query.