DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-IIIa

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster


Alignment Length:294 Identity:154/294 - (52%)
Similarity:199/294 - (67%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLPGVN 87
            :.|.:|||:||.::::..:|.|.|.|.||||:||||||||||:|.|||||||.||.|:|.|||||
  Fly    70 SSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPLPGVN 134

  Fly    88 VDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQ 152
            :||.||||..:.||.|.|||:|.:|||||||||:|.||:|...|.|...|:.| |||:||:||||
  Fly   135 IDLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHG-PKITGGQPRYQ 198

  Fly   153 IGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDGLETSVLGLQFRVEQKHFRK 217
            |||.||||||:..|||...|||.:|||||::..||:||.:|..|||||.:.|||:|||...||:.
  Fly   199 IGDIVRVNCTSSPSKPVCHLSWLINGEPVQKTHLRQYDKVVVNRDGLEMARLGLEFRVRSFHFKH 263

  Fly   218 GNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETVYASNSRADPVQGTSYRELFVTKILS 282
            |:|||||:|::|::|.:.||||||.||..:||.|||||||.|.:|                    
  Fly   264 GDMKLKCVAKISSLYLQSNEESVESDRQHRAPALESRETVAAKSS-------------------- 308

  Fly   283 LLFVQPNAASSTASAPSTPITPLVLLPVALAVMV 316
                  ..|::.:..||:.|   |.||..|.:::
  Fly   309 ------TIAAACSKLPSSLI---VSLPPVLLLLL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 61/93 (66%)
Ig 42..127 CDD:143165 60/84 (71%)
Ig 140..219 CDD:299845 48/78 (62%)
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 63/95 (66%)
IG_like 88..182 CDD:214653 63/93 (68%)
Ig 188..>227 CDD:299845 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MP4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.