DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and beat-Ic

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001285970.1 Gene:beat-Ic / 34945 FlyBaseID:FBgn0028644 Length:534 Species:Drosophila melanogaster


Alignment Length:401 Identity:125/401 - (31%)
Similarity:186/401 - (46%) Gaps:62/401 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSLLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYR 69
            |.|:....||..|||        ..|.||..|.:|:.|...|.||::.:.||||||||...||||
  Fly    45 LLLILVPDFIEALKD--------VSVMIPQAVKRGSNALFTCNYDMENDTLYSVKWYKGKREFYR 101

  Fly    70 YVPRDMPPAQTF-LLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIV 133
            |.|::.|..:.| :..|:||:.:.|:.:.|.|::|.|..:|:|.||:|.|||:|||....|:|.|
  Fly   102 YTPKENPAMKVFAMTSGLNVERNLSNQSHVVLQSVPLNISGKFTCEISVEAPTFQTAMVSGEMEV 166

  Fly   134 AYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDG 198
            ..||:|.: .::|.:.||:|||.|..||:...||||..|:|.:||..|....::.|.|.......
  Fly   167 VELPEEHT-VVTGIQARYRIGDLVDGNCSIKYSKPAANLTWTINGIVVPPHHIKTYQTEKRENST 230

  Fly   199 LETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETV----YA 259
            ||:....:.|.|..:||.||.|:|||.|.:..::....|..:|.|||:   ::.|..:.    |.
  Fly   231 LESVTSAIHFMVTNQHFLKGQMRLKCTANIFDIFKEEMESVIEEDRPR---IMASGRSYDINNYP 292

  Fly   260 SNSRADPVQG--TSYRELFVTKILSLLFVQPNAASSTASAPSTPI---------TPLVLLPV--- 310
            .....:..:|  ..:.|.::|..         :|.:|||..||..         :.|..||:   
  Fly   293 LEEHTNGERGGFEDHNESYLTYY---------SADNTASGASTAAHEIFWQFWPSQLTKLPINRQ 348

  Fly   311 -------------ALAVMVMATLAQGITRDIDTDKISMDRTAPGGIGITKETQQARELLAGRKEE 362
                         |.|:::...|.||   .:....|:...|.|   ...|..||.|.   .....
  Fly   349 LAGAWHWLCGGGGAAALLLFFLLQQG---PLGHQIINCQYTKP---ATGKVQQQQRN---SGSSS 404

  Fly   363 NRRTSHGKSAT 373
            |...:..|:||
  Fly   405 NIEVTASKAAT 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 42/94 (45%)
Ig 42..127 CDD:143165 39/85 (46%)
Ig 140..219 CDD:299845 27/78 (35%)
beat-IcNP_001285970.1 Ig 189..>246 CDD:299845 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.