DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and jam2b

DIOPT Version :9

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio


Alignment Length:265 Identity:57/265 - (21%)
Similarity:99/265 - (37%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEF-YRYVPRDMPPAQTFLLPG-VNVD 89
            :|..:..|.|.:.|.|.|.|.:..:.|....|:|.|.|.:. |.|...|.    |....| .::|
Zfish    35 VTTSKAKMDVHENTNAVLSCEFRTEKETNPRVEWKKRGKDVSYVYFEGDF----TGSYKGRASID 95

  Fly    90 LHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQIG 154
                 .|.:|||.|..:.:|.:.|||:..    |...:.|::.|..     |..:....|..::.
Zfish    96 -----GATLTLRGVTQKDSGVYHCEVTAR----QDKIKLGEVSVTL-----SVLVPPHAPTCEVP 146

  Fly   155 DYV------RVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVSGRDGLETSVLGLQFRVEQK 213
            :.|      .::|....|.||...||..:.:|:  .....:|...:    |:|            
Zfish   147 EAVMRGFSAELHCKDKLSVPAATYSWYKDNKPL--NTANPHDVHYT----LDT------------ 193

  Fly   214 HFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRETVYASNSRADPVQGTSYRELFVT 278
              :.|::|.|.:::.....:||                |:...|.|..|.|......:..||.:|
Zfish   194 --KTGSLKFKSVSKSDEGQYRC----------------EASNGVGAPKSCAGHHMKITEFELNMT 240

  Fly   279 KILSL 283
            .|:::
Zfish   241 MIIAI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 27/95 (28%)
Ig 42..127 CDD:143165 24/86 (28%)
Ig 140..219 CDD:299845 13/84 (15%)
jam2bNP_001121766.1 Ig 44..135 CDD:299845 29/108 (27%)
IG_like 44..134 CDD:214653 28/107 (26%)
IGc2 154..220 CDD:197706 16/101 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.