DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIc and jam2a

DIOPT Version :10

Sequence 1:NP_724042.1 Gene:beat-IIIc / 35037 FlyBaseID:FBgn0032629 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_073784686.1 Gene:jam2a / 100005261 ZFINID:ZDB-GENE-031204-3 Length:312 Species:Danio rerio


Alignment Length:137 Identity:33/137 - (24%)
Similarity:49/137 - (35%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 AQLECLYDLDGEALYSVKWYKDGNE----FYRYVPRDMPPAQTFLLPGVNVDLHNSSDAIVTLRN 102
            |:|.|.:..:.:....::|.:...|    |..|..|.:.|.|         |..:...|.|.||.
Zfish    36 AELSCEFKTEKDTNPRIEWKRKDKEKDVSFVYYGERFVGPFQ---------DRADIEGATVRLRR 91

  Fly   103 VNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSK 167
            |....||.:|||||..:.|......:..:.|...|...|..:....   ..|..|.:.|....|.
Zfish    92 VTQADAGEYRCEVSAPSDSISLGETNVTLRVLVPPQTPSCDVPSSA---LTGSQVELRCRDRHSI 153

  Fly   168 PAVKLSW 174
            |....:|
Zfish   154 PPAVYTW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIcNP_724042.1 IG_like 33..127 CDD:214653 24/88 (27%)
Ig strand B 42..46 CDD:409353 2/3 (67%)
Ig strand C 57..61 CDD:409353 0/3 (0%)
Ig strand E 96..100 CDD:409353 2/3 (67%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
Ig 140..>194 CDD:472250 7/35 (20%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 171..174 CDD:409353 0/2 (0%)
jam2aXP_073784686.1 None

Return to query results.
Submit another query.