DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and jam2

DIOPT Version :10

Sequence 1:NP_609829.5 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001072218.1 Gene:jam2 / 779665 XenbaseID:XB-GENE-493973 Length:295 Species:Xenopus tropicalis


Alignment Length:140 Identity:36/140 - (25%)
Similarity:53/140 - (37%) Gaps:19/140 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LGCRYALDGESLYSVKWYK---DGHEIYRYVPRDKPPGQSFPLPGVNIDLRNSS---DTQILLRR 149
            |.|:|.|:.|....::|.|   :|...:.|....           :..|||..:   ::.|.|:.
 Frog    43 LSCKYKLEKEHPVRLEWKKVVPNGDISFIYYNNT-----------LAADLRGRAEMIESSIWLKN 96

  Fly   150 VTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKP 214
            .|...||.|||||:  ||..|...:...:.:.|....|..:....|....|..|.:.|..|...|
 Frog    97 ATRADSGKYRCEVT--APKDNKSFQEIVIDLKVL
VAPGVPVCDVPPSAMSGTAVELKCRESEGFP 159

  Fly   215 VCHLSWLING 224
            .....|..||
 Frog   160 ASEYRWYKNG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_609829.5 V-set 87..183 CDD:462230 25/97 (26%)
Ig 188..>227 CDD:472250 9/37 (24%)
jam2NP_001072218.1 Ig 26..128 CDD:472250 25/97 (26%)
Ig strand B 41..45 CDD:409353 1/1 (100%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 90..94 CDD:409353 1/3 (33%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig strand G 120..123 CDD:409353 0/2 (0%)
Ig 134..230 CDD:472250 9/36 (25%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353
Ig strand F 208..213 CDD:409353
Ig strand G 223..226 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.