DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and F11R

DIOPT Version :10

Sequence 1:NP_609829.5 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:176 Identity:42/176 - (23%)
Similarity:68/176 - (38%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YILHVILVLIDISSSLTMT---EVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRYV 118
            :||.::|..:.:.|....:   ||:||.:    ....|.|.|:  |.|...|:|..|..:..|.|
Human    15 FILAILLCSLALGSVTVHSSEPEVRIPEN----NPVKLSCAYS--GFSSPRVEWKFDQGDTTRLV 73

  Fly   119 PRDKPPGQSFP-----LPGVNIDLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETM 178
            ..:.....|:.     ||           |.|..:.||.:.:|.|.|.||.|..  |:..|.:..
Human    74 CYNNKITASYEDRVTFLP-----------TGITFKSVTREDTGTYTCMVSEEGG--NSYGEVKVK 125

  Fly   179 TVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLING 224
            .:|:.|...|.:...... .||:...:.|:.....|....:|..:|
Human   126 LIVLVPPSKPTVNIPSSA-TIGNRAVLTCSEQDGSPPSEYTWFKDG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_609829.5 V-set 87..183 CDD:462230 26/100 (26%)
Ig 188..>227 CDD:472250 7/37 (19%)
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 29/117 (25%)
FR1 30..52 CDD:409538 6/25 (24%)
Ig strand A 30..33 CDD:409538 0/2 (0%)
Ig strand A' 37..41 CDD:409538 2/3 (67%)
Ig strand B 44..53 CDD:409538 2/8 (25%)
CDR1 53..58 CDD:409538 2/6 (33%)
Ig strand C 58..66 CDD:409538 2/7 (29%)
FR2 59..66 CDD:409538 2/6 (33%)
CDR2 69..83 CDD:409538 2/13 (15%)
Ig strand C' 69..74 CDD:409538 1/4 (25%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 9/38 (24%)
Ig strand D 86..90 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 2/3 (67%)
Ig strand F 105..113 CDD:409538 4/7 (57%)
CDR3 113..119 CDD:409538 2/7 (29%)
Ig strand G 119..128 CDD:409538 1/8 (13%)
FR4 120..129 CDD:409538 1/8 (13%)
IgI_2_JAM1 135..231 CDD:409542 7/37 (19%)
Ig strand A 135..139 CDD:409542 1/3 (33%)
Ig strand A' 141..144 CDD:409542 0/3 (0%)
Ig strand B 147..155 CDD:409542 1/7 (14%)
Ig strand C 163..168 CDD:409542 1/4 (25%)
Ig strand C' 170..172 CDD:409542 1/1 (100%)
Ig strand D 187..191 CDD:409542
Ig strand E 195..199 CDD:409542
Ig strand F 208..214 CDD:409542
Ig strand G 221..231 CDD:409542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.