DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-VII

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_733162.2 Gene:beat-VII / 43213 FlyBaseID:FBgn0250908 Length:517 Species:Drosophila melanogaster


Alignment Length:220 Identity:58/220 - (26%)
Similarity:102/220 - (46%) Gaps:34/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QIWYILHVILVLIDI-------SSSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYK-D 110
            :.|    :|.:|:.:       ..|..:..:.:|.::.|..|||..|.:.:..|.|:.|.|.| |
  Fly     3 RFW----IIALLLGLQQTKPINGQSDVLVNLVVPRYVERGSSATFKCTHNVRPEILFKVTWLKVD 63

  Fly   111 GHEIYRYVPRDKPPGQSFPLPGVNIDLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSES 175
            ..:.:.::....||.::..:.|..||..||::.|:.|:.|....||.:.||||.:.|.|...|..
  Fly    64 KGKFFEFINGRNPPFRNSTIEGAEIDWDNSNEQQVTLKDVQFDLSGQFYCEVSTDTPIFTKASAD 128

  Fly   176 ETMTVVVTPNHGPKITGGQPR--YQIGDIVRVNCTSSPSKPVCHLSWLINGEPVQKTHLRQYDKV 238
            |.|:|.: |..||.....:.|  :.:|:.:...|.::..:|..|::|||||:.|:..::|.:   
  Fly   129 ELMSVFL-PQTGPPTIKFRKRTPFAVGEKLFALCNTTRGRPAPHITWLINGKKVEDRYVRTH--- 189

  Fly   239 VVNRDGLEMARLGLEFRVRSFHFKH 263
                            .|.||:.||
  Fly   190 ----------------HVFSFNGKH 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 32/96 (33%)
IG_like 88..182 CDD:214653 32/94 (34%)
Ig 188..>227 CDD:299845 11/40 (28%)
beat-VIINP_733162.2 Ig 31..118 CDD:299845 28/86 (33%)
IG_like 34..118 CDD:214653 27/83 (33%)
Ig 141..>183 CDD:299845 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.