DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-Vb

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:126/293 - (43%) Gaps:76/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WYI---LHVILVLIDISSSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRY 117
            |.:   :|::||:..| ..|.:|::.:|..:....:.||.|.|.:.|.:|.||||||:|.|.:||
  Fly     6 WLLQLGVHMLLVVRRI-QCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRY 69

  Fly   118 VPRDKPPGQSFPLPGVNI----DLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETM 178
            .|...|....|.:.||.:    :..|.|..::.|..:.::|||:|||||||:||.|...:....|
  Fly    70 SPLTPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANM 134

  Fly   179 TVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLING------------------- 224
            ||...|.:.|.|:.....|:..|.|.|||::..|.....::|.:||                   
  Fly   135 TVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAH 199

  Fly   225 ----------------EPVQKTHLRQYDKVVVNRDGLEMARLGLEFRVRSFHFKHGDMKLKCVAK 273
                            ||  :.|..|..|::..:..:..||||||              |:|||:
  Fly   200 GYSMRRIVSQLNFYANEP--RFHQLQLQKLIQQKRTISPARLGLE--------------LRCVAE 248

  Fly   274 ISSLYLQSNEESVESDRQHRAPALESRETVAAK 306
            |.                 |.|.|:...|:.|:
  Fly   249 ID-----------------RYPHLQREGTMFAQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 40/99 (40%)
IG_like 88..182 CDD:214653 40/97 (41%)
Ig 188..>227 CDD:299845 13/73 (18%)
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 33/81 (41%)
Ig 41..130 CDD:143165 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.