DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-Va

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:312 Identity:87/312 - (27%)
Similarity:140/312 - (44%) Gaps:58/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WYILHVILVLID--ISSSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRYV 118
            |.:...|.:|||  |:.:|.:|::.:|..:....:.||.|.|.:.|.:|.|||||||..|.:||.
  Fly     5 WLMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFRYS 69

  Fly   119 PRDKPPGQSFPLPGVNI----DLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETMT 179
            |...|...:|.:.|:.:    .:.|.|..::.|.....:|:|||:|||||:||.|....:::.||
  Fly    70 PLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLADKADNMT 134

  Fly   180 VVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLINGE--------PVQKTHLRQYD 236
            |...|.:.|.|......|::.:.::..|.|..|.....|:|.||||        |...|.|..:|
  Fly   135 VAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTTDTSLAAHD 199

  Fly   237 KVVVNRDGLEMARLGLEFRVRSFHFKHGD--MKLKCVAKISSLYLQSNEESVESDRQHRAPALES 299
            .|      |...||.::|.::...|....  ::|||||:|.:.                 |.|..
  Fly   200 YV------LRRQRLQVQFFLQGQRFFQAGKILELKCVAEIENY-----------------PELRR 241

  Fly   300 RETVAAKSSTIAAACSKLP-------------------SSLIVSLPPVLLLL 332
            .:|::|..|......:::|                   :|||.:....:||:
  Fly   242 EKTLSASLSQYDNFNNQMPLRHANANSGSAQRSILCGRTSLISAFLAAILLI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 38/99 (38%)
IG_like 88..182 CDD:214653 38/97 (39%)
Ig 188..>227 CDD:299845 12/46 (26%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.