DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-Vc

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001356887.1 Gene:beat-Vc / 41575 FlyBaseID:FBgn0038084 Length:297 Species:Drosophila melanogaster


Alignment Length:274 Identity:88/274 - (32%)
Similarity:135/274 - (49%) Gaps:19/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPLPGV 133
            :..|.::.:.:|..|...:.|.|.|.||:...:|.||||||||.|.:||.|...|....||:.||
  Fly    23 AEGLHLSNLSVPRIIDVAQKAKLFCSYAMGNRTLNSVKWYKDGLEFFRYSPLTPPTTNWFPVKGV 87

  Fly   134 NIDLRNSSDTQIL----LRRVTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHGPKITGGQ 194
            .|...:....|.:    |.::|..|||.|||||||:||.|..:.::..|||.|.|...|.|:|.:
  Fly    88 TIADGSPHCNQFICNVELEKLTAHSSGQYRCEVSGDAPEFKLIDQTANMTVGVLPKFDPFISGVR 152

  Fly   195 PRYQIGDIVRVNCTSSPSKPVCHLSWLINGEPVQKTHLR-QYDKVVVNRDGLEMARLGLEFRV-- 256
            ..|:..|.:..||::..|.|:..|:|.||.:......|: |.::|..|.||..:....|..|:  
  Fly   153 HAYKYHDYLEANCSTEMSSPMAKLTWYINNKTAPGHSLQPQINEVSRNVDGFHLFASHLHLRLHL 217

  Fly   257 --RSFHFKHGDMKLKCVAKISSLYLQSNEESVESDRQHRAPALESRETVAAKSSTIAAAC-SKLP 318
              :.|..|...::|:|.|.|..|      .:|..:.:.|...|..|:....:..|...:| :..|
  Fly   218 DDQRFISKSEMLELRCTADIMGL------AAVRRESRVRTTILALRDAGTKQRLTENGSCMTGQP 276

  Fly   319 SSL---IVSLPPVL 329
            :||   ::||..:|
  Fly   277 ASLAAWLLSLVHIL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 43/99 (43%)
IG_like 88..182 CDD:214653 43/97 (44%)
Ig 188..>227 CDD:299845 13/38 (34%)
beat-VcNP_001356887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.