DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and CG5597

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:173 Identity:38/173 - (21%)
Similarity:73/173 - (42%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKSATLGCRYAL-DGESLYSVKWYKDGHEIYRYVPRDKPPGQSFPLPGVNIDLRNSSD------- 142
            ::...|.|.|.: :.....:||||:|...||::: ...||   :.:|    :.||..|       
  Fly    39 MEPTILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPP---YAIP----EFRNEIDSTYESST 95

  Fly   143 ------TQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNHGPKITGGQPRYQIGD 201
                  :.:.|...|:.::|.|:|.|.   .:.||.|..:.:.|:...|:..:::    ...|.:
  Fly    96 EPSKQYSSLALINPTIATTGDYKCVVQ---TSLNTFSSHQRVQVIDLRNYTLELS----HKTIHN 153

  Fly   202 IVRVNCTSSPSKPVCHLSWLINGEPVQKTHLRQYDKVVVNRDG 244
            ..::|||.:...|...::.:.|...|.|.....|:    |.:|
  Fly   154 ETQLNCTVTNVYPRPTITIISNDMDVVKREPMVYE----NEEG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 26/109 (24%)
IG_like 88..182 CDD:214653 26/107 (24%)
Ig 188..>227 CDD:299845 6/38 (16%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.