DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-IIIb

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:251 Identity:175/251 - (69%)
Similarity:207/251 - (82%) Gaps:2/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHVILVLIDISS--SLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGHEIYRYVPRD 121
            |.::|:.:...|  .|||||:|||.||||.:.|.|||::.|||||||||||||||.|.|||||||
  Fly    16 LFILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEFYRYVPRD 80

  Fly   122 KPPGQSFPLPGVNIDLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESETMTVVVTPNH 186
            .||||.||||||:::|:||:|..::||.|:|||:|.||||||||||:|.|||..|.|.|||||.|
  Fly    81 MPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIVVVTPKH 145

  Fly   187 GPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLINGEPVQKTHLRQYDKVVVNRDGLEMARLG 251
            ||:||||||||||||:|||||||:.|:|||||||||||....::.||.|:.::|.|:|||:||||
  Fly   146 GPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLEVARLG 210

  Fly   252 LEFRVRSFHFKHGDMKLKCVAKISSLYLQSNEESVESDRQHRAPALESRETVAAKS 307
            ||||||. |||||||||||||||||:|.||||||||||:..|.|.|||||||.:||
  Fly   211 LEFRVRGXHFKHGDMKLKCVAKISSVYWQSNEESVESDKHQRIPVLESRETVMSKS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 66/95 (69%)
IG_like 88..182 CDD:214653 65/93 (70%)
Ig 188..>227 CDD:299845 32/38 (84%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469585
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MP4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.