DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IIIa and beat-Ib

DIOPT Version :9

Sequence 1:NP_001188828.1 Gene:beat-IIIa / 35035 FlyBaseID:FBgn0265607 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:322 Identity:107/322 - (33%)
Similarity:161/322 - (50%) Gaps:44/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ATSLQIWYILHVILV--LIDISSSLTMTEVKIPNHIMRLKSATLGCRYALDGESLYSVKWYKDGH 112
            |..|:..:|:..|.:  |..::..|....|:||:.:.|..:|.|.|.|.::.::||:||||:...
  Fly     5 ALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLYTVKWYRGRR 69

  Fly   113 EIYRYVPRDKPPGQSFPLPG-VNIDLRNSSDTQILLRRVTLQSSGLYRCEVSGEAPAFNTVSESE 176
            |.|||.|::.|..:.|.... ::::...|:.:.:|||.|....||.:.||||.:||.|:|...:.
  Fly    70 EFYRYTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEVSADAPTFDTSIVAA 134

  Fly   177 TMTVVVTPNHGPKITGGQPRYQIGDIVRVNCTSSPSKPVCHLSWLINGEPVQKTHLRQYDKVVVN 241
            .|.||..|...|.|||...||::||::..||:|..|||..:|:|.||...|...:||.||   :.
  Fly   135 DMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQVPPNYLRIYD---IQ 196

  Fly   242 R---DGLEMARLGLEFRVRSFHFKHGDMKLKCVAKISSLYLQSNEESVESDRQH-----RAP--- 295
            |   :.||.|.|.::|.|...||....:||||.|:|..:|.|.:|:.:|.||..     |:|   
  Fly   197 RHVAEHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEEDRPRILASGRSPDMN 261

  Fly   296 ---------ALESRETVAAKSSTIAAACSKLPSSLIVSLPPVLLLLL---------FQNWNW 339
                     |.|..|.....|:   |||...      :..|:|.|||         ::||.|
  Fly   262 MYPFDQPGDADEHNELFLIHSN---AACGPF------AWHPILFLLLWPSFWVFAAWENWLW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IIIaNP_001188828.1 Ig 87..183 CDD:299845 35/96 (36%)
IG_like 88..182 CDD:214653 34/94 (36%)
Ig 188..>227 CDD:299845 18/38 (47%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.