DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and I-2

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_568768.1 Gene:I-2 / 835296 AraportID:AT5G52200 Length:191 Species:Arabidopsis thaliana


Alignment Length:168 Identity:31/168 - (18%)
Similarity:59/168 - (35%) Gaps:52/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RTRFDKMNLGVPVHSDPYEVENESASSIKRETGEKVMSHKELME-------------------KL 50
            |.::|:.|:          ||.||...::::..|....:..:|:                   :.
plant     8 RVQWDEANI----------VEIESNKPVRQKITEPKTPYHPMMDDDGSLSPRGRAFDECVDDMQR 62

  Fly    51 HKEVKLTTPDFFAHDP------------SCSSDDSEDFEFLETIKE---RARRISFVRRRKLHYT 100
            .:|::....|..|...            |.|.::.|:.:.::..:|   ..:...|...||.||.
plant    63 AEELRNVLNDAAASSSRNSSQGSGGGGWSSSDEEEEEADPMDQDEEGSGSGKNERFNAHRKAHYD 127

  Fly   101 EFSTVELAR---RLIREEFTE-----SSESQLSVDDEH 130
            ||..|:..|   ....||..|     .|:|:.:.:..|
plant   128 EFRKVKELRSSGSFYEEEEEEDDGAKGSKSETTTNSRH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 22/126 (17%)
I-2NP_568768.1 IPP-2 9..141 CDD:368219 24/141 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12398
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.