DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12620 and 2810408A11Rik

DIOPT Version :9

Sequence 1:NP_001260525.1 Gene:CG12620 / 35034 FlyBaseID:FBgn0032626 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001369390.1 Gene:2810408A11Rik / 70419 MGIID:1917669 Length:456 Species:Mus musculus


Alignment Length:314 Identity:60/314 - (19%)
Similarity:98/314 - (31%) Gaps:109/314 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KRTRFDKMNLGVPVH--------------SDPYE-----VENESASSIKRETGEKVMSHKELMEK 49
            |..|:|:||:....|              ..||.     .|:.||.|..:.|.:.|......|:.
Mouse   151 KSQRWDEMNILATYHPADKDYGFMKADEPRTPYHRLQDTDEDPSAESSLKVTPQSVAERFATMDN 215

  Fly    50 LHKEVKLTTPDFFAHDPSCSSDDSEDFEFLETIKERARRIS--FVRRRKLHYTEFSTVELARRLI 112
            .       .|....:..:.:|.|:::|         |:..|  |.:.||:||:|...::..:.|.
Mouse   216 F-------LPKVLQYGDNKNSKDTDNF---------AKTYSSDFDKHRKIHYSEGKFLKSPKNLP 264

  Fly   113 REEFTESSESQLSVDDEHISEIAEEECPPCG----------------TDS-----DDLLPY-FQY 155
            .||.:..:.:.:|..::.::...:......|                |||     :|...| .|:
Mouse   265 TEEESIGASASISSSNQAVATDLKPRPVEKGWAGRLATGVKNDTVLMTDSHVLSTNDSATYRNQF 329

  Fly   156 DRATDQSM-----------------------------ISDDSL------------PKEDPEPGFH 179
            ..|:|.||                             |.|:..            ||..|..|..
Mouse   330 PSASDSSMGQLANLQRKEYYSKGRYLRSGSRPELGEDIEDEEQDSPSGLTWVTENPKGTPVNGSQ 394

  Fly   180 PAHHCYNKLISQTPDPPIVYVPAEPEPQPEPQPEPPV--EPRPEPEPEPEPETV 231
            ...:|:.|       .|....|...|.:......||.  ..|.||.|....|::
Mouse   395 VTPNCWAK-------GPRCRSPGSSEKEHGSNQNPPSWNGRRREPGPRQGDESL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12620NP_001260525.1 IPP-2 <21..111 CDD:282789 21/96 (22%)
2810408A11RikNP_001369390.1 IPP-2 153..268 CDD:398578 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1321970at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.